PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN45518.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 410aa    MW: 44772.2 Da    PI: 6.0973
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN45518.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.97.6e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +++++G g+W++ +++    R++k+c++rw +yl
       KHN45518.1 14 KGPWTPEEDQKLLAYIEEHGHGSWRALPAKADIQRCGKSCRLRWTNYL 61
                     79******************************66************97 PP

2Myb_DNA-binding521.7e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++ +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++
       KHN45518.1  67 RGKFSLQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.978961IPR017930Myb domain
SuperFamilySSF466896.74E-3011108IPR009057Homeodomain-like
SMARTSM007173.0E-131363IPR001005SANT/Myb domain
PfamPF002491.4E-151461IPR001005SANT/Myb domain
CDDcd001671.99E-101661No hitNo description
PROSITE profilePS5129425.46362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2565116IPR009057Homeodomain-like
SMARTSM007173.5E-1666114IPR001005SANT/Myb domain
PfamPF002491.1E-1567111IPR001005SANT/Myb domain
CDDcd001675.26E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000902Biological Processcell morphogenesis
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MGRSPCCDKV GLKKGPWTPE EDQKLLAYIE EHGHGSWRAL PAKADIQRCG KSCRLRWTNY  60
LRPDIKRGKF SLQEEQTIIQ LHALLGNRWS AIATHLPKRT DNEIKNYWNT HIKKRLTKMG  120
IDPVTHKPKN DALLSSDGQS KTAANLSHMA QWESARLEAE ARLVRESKIR SHSLQHQLGS  180
SSSTFASSSS ASTSASALNN NNKPEAQRPP PPPSRSSLDV LKAWNSGGWL ESNEGNGGIV  240
SNVGVSGDLE SPTSTLSFSE NAPPIMNGIG GENNNNNDSA MPMIEFVGNS GNSSSLVKEE  300
AEQEWKSTYD SSITTTFSSG LHEFTMNMEG TWASESLRTS GSHDIVEEGF TNLLLKTNSD  360
DPSLSSEDGG ESKNGDGGGG TNSDFYEDNN NYWNSILNLV NSSPSHSPMF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0936130.0BT093613.1 Soybean clone JCVI-FLGm-24C14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003554566.10.0PREDICTED: myb-related protein 330
TrEMBLA0A0B2SKV50.0A0A0B2SKV5_GLYSO; Transcription factor MYB39
STRINGGLYMA19G02890.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF83534127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.11e-109myb domain protein 16
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]